top of page

McDonnell Genome Institute

Washington University

CircRNA

chr6|104744159|104750472|-|HACE1|ENST00000262903.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

LGSCRRHYSR

Amino Acids from 5' Exons

WFWEVVEDITQEERVLLLQFVTG,GSGKLKTLLKRREFFSYSLLRA,VLGSCRRHYSRGESSSLTVCYGQ

Amino Acids from 3' Exons

AEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYEL,RSTSSLLLNFEQEPFSLRSMLFYRAFICSFHPPSYSFLMNMN,GVRPACYTSNDKSHSASDQCFFTGLSYVHSTLPHTAFII

bottom of page