McDonnell Genome Institute

Washington University

CircRNA

chr6|100715461|100718251|-|ASCC3|ENST00000324696.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9956

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

AGHQVESTQSMIR

Amino Acids from 5' Exons

MQQLNNMDEVCYENVLKQVKAGHQ,CSSITWMKYVMKMFSKRLDT,AAVEHGSMLKCFEASKGWTP

Amino Acids from 3' Exons

VESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANK,WNPHRVGFSDCLQLYLTTSMLPHFYMLIHTLDFSSLMAVFDQYLLDRHFWGLNVQI,GIHTEYDKDSRTVCNFTLPRCCHIFTCSIHWTFLLWPFSTSTSWTDIFGDMCK