McDonnell Genome Institute

Washington University

CircRNA

chr6|100661805|100848707|-|ASCC3|ENST00000324696.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9743

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

11

Peptide

NPIESQFLESLADNLNAELELIMGEKQLK

Amino Acids from 5' Exons

GTQIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQRNPIESQFLESLADNLNAE,EHKYMLQKEAPLLTLEFMSCRYLVELDDHNLTNLGKELQRMINSAITSLCSLNETQLRVSFWKALQITMQ,NTNICCKKRLLCPWNFRCHADIWSSWTTTIQIWGRNNYNNATQPLPHFAHSTKPNESVSGKPCRPKCR

Amino Acids from 3' Exons

LELIMGEKQLKVGLHFSSHFTRTLLVTRKQRLSNRCLAPFLHHLPLQLVMLLIELFLILVKMILLLLCRQKKNMAIGFFLVKIHFHLTCMIWTTLTNCQMVKLRKLAIIRSFMNISRRLAPQNSSLWKKQMAPFCGVKLKSTIQLRKLKCQEKIFAVLYMICLLLLKVVMNFRM,WNWERSNKWGCISLHDISLEGLCWSQGNKGYQTDVWPLSFIICHCSLCYSNYFSFSRSYCSCADDRKRTWRGFFWKFSIFIHAFGPLRTANKWNSENYKPRLEVSETSPGGLHPRTQACGKNKWLLFVVSKVPKFNFEGNDSAKSRRSLLYFIYACFYKWTSG,GTDNGREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFGPFPSSSATAACNATNRIISHFSQDDLTALVQMTEKEHGDRVFFGKNLAFSFDMHDLDHFDELPINGETQKTISLDYKKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDE