McDonnell Genome Institute

Washington University

CircRNA

chr5|98868494|98873723|-|CHD1|ENST00000284049.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9605

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

HSALLDAIAR

Amino Acids from 5' Exons

LSESKSDGRERSKKSSVSDAPVHITASGEPVPISEESEELDQKTFSI,VNPSLMVGKDPRNLQCQMLQFISRQVVNQFPFLKNLKSWIRRHSA,EIQVWGKIQEIFSVRCSSSYHGKWTSSHFRIRAGSEDIQH

Amino Acids from 3' Exons

IRCNCSRCVSVRNRPTTGRIGTWLHSIKGFFRNRTN,LDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERT,MQLLEMLSLISQKQTLDDWENWYIMVALKHRIVLQEQNEQ