McDonnell Genome Institute

Washington University

CircRNA

chr5|97013647|97022484|+|LNPEP|ENST00000231368.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9494

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LMTGWHPMELK

Amino Acids from 5' Exons

VSSILQKKCCGSKITMVIILYTMQMMIGKHSISKILMFVTKTEPTLSTTSLNLQ,CHQSYRRSAVGQSEYKHEWLLYCTLCRLGSTNPSVENKSLCSEQRPSQPYQQHLTCR,VINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELA

Amino Acids from 3' Exons

TRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQ,LGYLNYFKTKFNNKLGLMRALHLCESFGQPCSLLAPTTWGTALLLPNCLMTGWHPMELK,GIITSKPNSTTNLDGHSIYARASVSPARVCLHPQPGELLYYCHETVLDGIQWNSK