McDonnell Genome Institute

Washington University

CircRNA

chr5|96776403|96790643|-|ERAP1|ENST00000296754.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9339

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

SLNGACILNMLR

Amino Acids from 5' Exons

VKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLE,KDSSALKKMVLSSVVSNRQLKPLKKTSVGWIRILIKSECGCKVKSLN,KRILQLFERKWFSAPLCPTDNNHRKHRLDGEFNQSVAAKKA

Amino Acids from 3' Exons

GACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWDSMAS,ELVFICGSILVLTHLKVVLYSISRSIAIKIQKTRTCGIVWQ,SLYSEYAKGVSCRIKWYCTVSPEALKYKKRGPVGYGK