McDonnell Genome Institute

Washington University

CircRNA

chr5|95752238|95788858|+|RHOBTB3|ENST00000379982.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

IFQLEYFMIQALNQK

Amino Acids from 5' Exons

LEYFMIQALNQKTSEKMKKRKMSNSFHGIRPPQLEQP,WSILFKPIRRQVKKRKEKATPFMELDHLNLNNQ,GVFYDSSLKSEDKKNEEKKNEQLLSWNTTSTTT

Amino Acids from 3' Exons

FHHSDCLSTWLLHFIATNYLIFSQKPEFQDLS,FTTLIAFQPGYFISLLLTTSSSVKSLNFRIFQ,SPLLPFNLATSFHCYLPHLQSKAISGSF