McDonnell Genome Institute

Washington University

CircRNA

chr5|93958776|93964523|-|FAM172A|ENST00000395965.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9513

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

AVAIITK

Amino Acids from 5' Exons

VDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVA,MPLRVNQRVLSLVRMLQIHRNWFFMVVVLSGQGSGLEDLLMKIWTVAHRYRLLKELW,RCHETKEFYLYEGCFDKSTETDGFNSWWCCQGRAVGKTYYKRSGQWHTDTVYKSCG

Amino Acids from 3' Exons

IITKYVYELLEKDCNLKKVSIP,SSRSMYMSSWKRIVIKKYLF,HHEVCIAPGKGLFEKSIYS