McDonnell Genome Institute

Washington University

CircRNA

chr5|90525034|90525300|-|LYSMD3|ENST00000315948.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9087

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

YMHLEIVQTVIFWRR

Amino Acids from 5' Exons

ILTLWQGGIRIVVFLFQEFSQVVKYMHLEIVQTVIFWRRMLKCMNFDPEEKRKSEEVHQEIDLTTLYQKIYKKEIHMQPFSTVV,FHYGREASESFSSSRSSVKWSSTCIWKLFRQYFGGGCSVTSIQRKRESPKKYIKRTRHYSINKRYTRRRYIKCNSPSVLLY,FNIMAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCT

Amino Acids from 3' Exons

ILTLWQGGIRIVVFLFQEFSQVVKYMHLEIVQTVIFWRRMLKCMNFDPEEKRKSEEVHQEIDLTTLYQKIYKKEIHMQPFSTVV,FHYGREASESFSSSRSSVKWSSTCIWKLFRQYFGGGCSVTSIQRKRESPKKYIKRTRHYSINKRYTRRRYIKCNSPSVLLY,FNIMAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCT