McDonnell Genome Institute

Washington University

CircRNA

chr5|87376880|87389527|+|RASA1|ENST00000274376.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

GAQQLILQK

Amino Acids from 5' Exons

LILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISME,LYCKRNFMSMLYHMYVDKTEHYWPASYGFFFTKSLNRCCYAHMTEKAWK,YTAKGTSCSLCFITCMWTRPNTTGQHPTEDFSSRKAIVVVMHTKQRNKHG

Amino Acids from 3' Exons

NVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ,MYLNFRTLQSILERTCPVIQHCMRFAWLIQMNFERSVMSVVHS,CTTSGHYRAFNGPVPFSSIADLRGSFRTSNAQAWCTA