McDonnell Genome Institute

Washington University

CircRNA

chr5|87376880|87386903|+|RASA1|ENST00000274376.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9963

52

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

MIMFLDELGLILQK

Amino Acids from 5' Exons

LILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISME,LYCKRNFMSMLYHMYVDKTEHYWPASYGFFFTKSLNRCCYAHMTEKAWK,YTAKGTSCSLCFITCMWTRPNTTGQHPTEDFSSRKAIVVVMHTKQRNKHG

Amino Acids from 3' Exons

EPYMEGVNPFIKSNKHRMIMFLDELG,SPTWKVSIHSSKATNIVSCFMNL,ALHGRCQSIHQKQQTSYDHVFRTW