McDonnell Genome Institute

Washington University

CircRNA

chr5|83553363|83555038|+|VCAN|ENST00000265077.7

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9415

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

VPISQASCLTK

Amino Acids from 5' Exons

IPRHVTMAGTNSKGSATNTLPIDAHGMQLNGNAVCRVPISQASCLTKNKCLLI,YRDMLWLAQIPRAVLQILCPSTHMGCSTGMPSAGCPSHKHPVSRRTNVC,TETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVN

Amino Acids from 3' Exons

VWAMIISGASMTRCLSMTSVGLMAAH,CGPLSVDRPQQDVALPLDWQHT,VGHDYQWIGLNDKMFEHDFRWTDGSTL