McDonnell Genome Institute

Washington University

CircRNA

chr5|83483512|83512396|+|VCAN|ENST00000265077.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

FDAYCFKR

Amino Acids from 5' Exons

AKMFINIKSILWMCSTLIVTHALHK,PRCSIRASYGCVQPPMRYIK,QDVHKYKEHLMDVFNLNSNPCAT

Amino Acids from 3' Exons

VMCSTSLSPVNSPSRRLQKSVKTRMPGWQQWGNSRRHGGTALTSAITGGCRMPACATLLWPGPSVEVVYLGEPCIVLRTRQASLPLIADLMPTALN,CVPPHCPQIHLRGGCKRVKPGCQAGNSGGTPGGMEERLPVRLRVAVGCQRAPPCDCGQGPVWRWSTWGENPVSFEPDRLPSPQICLLL,DVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFK