McDonnell Genome Institute

Washington University

CircRNA

chr5|80665142|80813741|+|MSH3|ENST00000265081.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9301

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LAPMFLQK

Amino Acids from 5' Exons

SQRNVGPGMFQSLWKNKNSAAILPFLKVESRQNLCRRDLQFCQNVLILMISVFYTQRMQFLLKIRNVKLIK,AKEMSEDQECFKVSGKIERILLRFCPSSKSPDRISAGEICSSAKMYFYQSSTRKECSFFRFETSNSK,PKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQK

Amino Acids from 3' Exons

EDSERVMIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFT,RTQRELPDQTWVERAPTNKLHLPSWLRLAPMFLQKKRQLGLWMAFSQ,GLRESNDNYRTKHGWKELLHKTSCIDYHHGSDWLLCSCRRSDNWDCGWHFHK