McDonnell Genome Institute

Washington University

CircRNA

chr5|79401898|79457018|-|HOMER1|ENST00000334082.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9885

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

8

Peptide

KQNVCTSGEQPIFSTR

Amino Acids from 5' Exons

FSNQQTLGGTGYPQRKCQTHCSPAGVHCQCETMETATCCLSRGSRTSAQA,SAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKR,QQSANIGRLNWLPSKEIMPNSLQPCWSPLPMNNGNSNLLPIKRKQNVCTS

Amino Acids from 3' Exons

GTTYLQHSSSCLPNPKHKEELGTHQQACSYCVLFLQHKKCVDNQFRWLK,EQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSK,NNLSSALELMSSKLTQTQRRTGYPPASMQLLCLISMTAQEMCIGSVMAQ