McDonnell Genome Institute

Washington University

CircRNA

chr5|7870769|7892913|+|MTRR|ENST00000264668.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9665

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

8

Peptide

TAGKPWLLSFTVTCLEVMRR

Amino Acids from 5' Exons

FHCYMPSDEEVSVTICYTAGTGKGHRRRNMASCGTWIFCRSSLYIR,FTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDK,SLLHALKGGFCYYMLHSRDRQRPSQKKYVSKLWYMDFLQIFTVLVNPI

Amino Acids from 3' Exons

LKFISPRKAPFCLQHCGISVYCHNRGSAEGSMYRLAGLVGCFSSSAKHTCIPRQRESPGS,SSLFHPGKLHFVFNIVEFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPK,QVYFTQESSILSSTLWNFCLLPQQRFCGREYVQAGWPCWLLQFFSQTYMHPMKTAGKPWLL