McDonnell Genome Institute

Washington University

CircRNA

chr5|78165609|78216237|-|AP3B1|ENST00000255194.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

23

Peptide

EFQLVAGSVVMAFEEVCPDRIDLIHK

Amino Acids from 5' Exons

LEILTNLANEANISTLLREFQ,LKFQTWQMKPTYQLFFENF,NFDKLGKSQHINSSSRIS

Amino Acids from 3' Exons

LVAGSVVMAFEEVCPDRIDLIHKNYRKLCNLLVDVEEWGQVVIIHMLTRYARTQFVSPWKE,WLAVLWLLKKYARTEIFIKITASYVTYWMLKSGGRLSSTCLDMLGHSLSALGK,GSWQCCDGFRSMPGQNRSDSKLPQAMLTSGCRVGAGCHNPHANSICSDTVCQPLER