McDonnell Genome Institute

Washington University

CircRNA

chr5|78156257|78181662|-|AP3B1|ENST00000255194.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

LLDSITGDELEDNGK

Amino Acids from 5' Exons

KLLLKVWLLRNYCKCNLHNMVKLLNIWPNSWTVS,NSCCKCGCYKEITANATCTTWNYTYGQTPGQYH,IVVAESVVVIKKLLQMQPAQHGEIIKHMAKLLDSIT

Amino Acids from 3' Exons

GDELEDNGKNFYESDDDQKEKTDKKKKPYTMDPDHRLLIRNTKPLLQSRNAA,VMNKTMERISTNLMMIRRKRLTKRRSRILWIQIIDSLEIQSLCFRAGML,IRRQWKEFLRISEGKDQKEEAVYYGSRSTLNKYKAFASEQECC