McDonnell Genome Institute

Washington University

CircRNA

chr5|76611019|76632026|+|IQGAP2|ENST00000274364.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

GVVAVGYINEAIDEGNPLR

Amino Acids from 5' Exons

ELLGTSMKLLMKGILGLKLCSYLLRILVMWTQPMPSTTRMFYTMLNHRNS,SCSCRVHQSYRESFEDFRNFAPTYCEYCGPSPCPALPGCFIPCITETR,VVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAHAQHYQDVLYHAKSQKLG

Amino Acids from 3' Exons

GLLWWLMLISVWKEKNQVIFCLYSLPLLMQMTSRSVLTNTMMPLRQKSSNLKE,GYSGGCSVFGRKKIKYFVCIEVFHFCKHNPGVCQILCPCEGKRAQIK,VTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSER