McDonnell Genome Institute

Washington University

CircRNA

chr5|76597438|76632026|+|IQGAP2|ENST00000274364.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

3

Peptide

GQAAVDHINAVIPEGDPENTLLALK

Amino Acids from 5' Exons

GRLQWTISMLSFRKVTPRIRCLHRNQRPSCLLFIPLLLPCIRTNFSTSRNRTP,AGCSGPYQCCHSGRPREYAACTEETRGPAACCLSLCCCHVSERTFQPPETEHH,QAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFNLQKQNTM

Amino Acids from 3' Exons

GLLWWLMLISVWKEKNQVIFCLYSLPLLMQMTSRSVLTNTMMPLRQKSSNLKE,GYSGGCSVFGRKKIKYFVCIEVFHFCKHNPGVCQILCPCEGKRAQIK,VTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSER