McDonnell Genome Institute

Washington University

CircRNA

chr5|76588905|76600972|+|IQGAP2|ENST00000274364.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9918

36

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

15

Peptide

SPAIGLNNLDKAYVERLYLFK

Amino Acids from 5' Exons

FVSVQTRNSTPDPGFVGQSRLH,LYLFKLGIAPQIQDLLGKVDFT,CICSNEHPRSRICWAKTSQ

Amino Acids from 3' Exons

NYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVE,TTWPTRSFLLWKCCLLLLYTRPWKATILCLCRINSEAPQATIWTRHMWN,LLGPRGAFDCCGNVVCCCFTKPGLGKQRSCVCAESTQKPRNRLKQSGQGICGT