McDonnell Genome Institute

Washington University

CircRNA

chr5|76562395|76637176|+|IQGAP2|ENST00000274364.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9154

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

3

Peptide

SRWMEVCLVEELPPTTELEEGLR

Amino Acids from 5' Exons

VDGSLLSRIATNHIGRRAPEWSLPCKVSQVLCPENGIREKDLCGTNTL,WMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYK,GWKFALKNCHQPLNWKKGSGMEFTLQSPSSLPRKWYQRKRSMMWNKHVI

Amino Acids from 3' Exons

CLVTVHGSNSTCTKNMTTITTLIQKRVPGSHLNHACIKNHGSQEKKS,VRFMAQTQPAQKILLLQHFKREFLGHTIMLVRIMAHRKRNR,SSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLYKESWLTGKEIE