McDonnell Genome Institute

Washington University

CircRNA

chr5|72877227|72889957|+|TNPO1|ENST00000337273.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9799

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

23

Peptide

NLLILYDAIGTLADSVGHHLNKPYMLQR

Amino Acids from 5' Exons

YMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLP,TCYRGLKIKMKMWLKPVNFGLLNSQYAKMYSGIFL,HATEDSRSRKCGFRSLILANFSTANMQRCTRKASS

Amino Acids from 3' Exons

CLCYPRRGGLYRTCSLPCLYTYPGLCIIPAEPAHSLRCHRNISRFSRTSFKQT,AFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKP,PLLPKRRLVQNLFLTLLIYLIPWSLHLVNTSIRTCSFFTMPEHQIQDIITN