McDonnell Genome Institute

Washington University

CircRNA

chr5|67114086|67121102|+|MAST4|ENST00000261569.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9651

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

LISNGAYGNLIR

Amino Acids from 5' Exons

EFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLE,NLIRKNFTTYWKQQKAMPKKDRVLKPTFPGTSLANWDSIRIPWK,ISGRILLPIGSSRRPCQRRTGYNRHSQVHHPTGTQGSLG

Amino Acids from 3' Exons

SSNASLKLRRKPRESDFETIKLISNGAY,ALMPPNFEGNLGKVILKRLNLAMEPM,LCLPETSKETSGKFNDIDQWSLW