McDonnell Genome Institute

Washington University

CircRNA

chr5|67090161|67145379|+|MAST4|ENST00000261569.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9487

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

LPPALETPMRSQESQPFLLK

Amino Acids from 5' Exons

EIALKIVQEISPPVPQPIFHLHG,KPSRSKKFLPQCLSPFFICTE,NSPQDSPRNFSPSASAHFSFAR

Amino Acids from 3' Exons

ATAINIQLFRYKQQTTQFWPTSQTGYFNRGRARSCLLPWRPPGARKASPSSRVCPGGAGHHPSQHHQQLHPV,QQLSTSNSSDTESNRHKLSSGLLPKLAISTEGEQDEAASCPGDPHEEPGKPALPPEECAQEEPEVTTPASTISSSTLS,NSYQHPTLQILKATDINSVLAYFPNWLFQQRESKMKLPPALETPMRSQESQPFLLKSVPRRSLRSPPQPAPSAAPPCQ