McDonnell Genome Institute

Washington University

CircRNA

chr5|66153462|66162592|+|SREK1|ENST00000334121.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

2

Peptide

FRDPSSVGVAQHLTNTVFIDR

Amino Acids from 5' Exons

QRTSCFFLQSMLCVSSIKCWRGPASNHGFYQSSDSCSLCR,NAPLAFSSKVCYVKFRDPSSVGVAQHLTNTVFIDRALIVVPCAE,THLLLFPPKYVMLSFVIHQVLAWPSILTRFLLTELLFLVQK

Amino Acids from 3' Exons

TTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPL,QRQLINYLNFLNKLEKSLCGWQVMRLSQLGLLLWNLQTKILYQGPLLLMELCLETGH,NDSSTTIFTSWRSEVCADGRDSANSVCFCGICRPKFCTKGPCFWSYVWRQATE