McDonnell Genome Institute

Washington University

CircRNA

chr5|66038382|66069020|+|ERBB2IP|ENST00000506030.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

DLHGSQGSLALSVADR

Amino Acids from 5' Exons

SKPLIPLQKETDSETQKMVLTNYMFPQQPRTED,PNPYLFKKKLIQRPRKWCLPTTCSLNSQGLRM,QTPDTSSKRNFRDPENGAYQLHVPSTAKDG

Amino Acids from 3' Exons

SMLSRSFNSNFTTVSSFHCGSSRDLHGSQGSLALSVADRRGSGGHIFR,ACCQGPLIPILLLAVFTVAALGICMAARAVLPVLQTEEVLVGTFF,HAVKVLFQFYYCKQFSLWQLGSAWQPGQSCLECCRQKRFWWAHFS