McDonnell Genome Institute

Washington University

CircRNA

chr5|65583037|65583219|+|PPWD1|ENST00000261308.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9779

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

VQILIEMFLMR

Amino Acids from 5' Exons

FTKREPEDTKSADSDRDVFNEKPSKEEVMAATQAEGPKRVSDSAIIHTSMGDIHTKLFPV,LPNENQKIRKVQILIEMFLMRNLLKKKSWQLLKLKDLNEFRTVPLSTPAWETFTPNFFLL,YQTRTRRYEKCRFSRCFETFRRSHGSYSSRTTSFGQCHYPHQHGRHSHQTFSC

Amino Acids from 3' Exons

FTKREPEDTKSADSDRDVFNEKPSKEEVMAATQAEGPKRVSDSAIIHTSMGDIHTKLFPV,LPNENQKIRKVQILIEMFLMRNLLKKKSWQLLKLKDLNEFRTVPLSTPAWETFTPNFFLL,YQTRTRRYEKCRFSRCFETFRRSHGSYSSRTTSFGQCHYPHQHGRHSHQTFSC