McDonnell Genome Institute

Washington University

CircRNA

chr5|61494259|61525976|+|ZSWIM6|ENST00000252744.5

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.996

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

TPSSTPAGGPSGMVR

Amino Acids from 5' Exons

VREMLKMRDSNGARMLTLITEQFMADPRLSLWRQQGTAMTDKYRQLWDEL,CGRCRGTPMGPACPQSNSWLTLACHFGGNKALQLTNTGSSGMSW,AGDVKDEGLQWGPHVDLDNRAIHGPSPVTLAATRHCNDQIQAALGA

Amino Acids from 3' Exons

IHRTGHIGQCSPEPSRHAISTGRIATCSTLSAVTYTPTTVTMTTLKTPSSTPAGGPSGM,FIEQATSDSVHPSHRGMRSPLAGPLAAHYQQPIHQLLLPRHKLPLRLPRVAPLA,SSNRPHRTVFTRAIEACDLHWQDSHLQHIISSDLYTNYCYHDDTENSLFDSRGWPLWH