McDonnell Genome Institute

Washington University

CircRNA

chr5|59988487|59988717|-|PDE4D|ENST00000502484.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9824

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

QLEQADLK

Amino Acids from 5' Exons

ASEETLHSSNEEEDPFRGMEPYLVRRLSCRNIQLPPLAFRQLEQADLKSESENIQRPTSLPLKILPLIAITSAESS,PLRKHYIPVMKRKTLSAEWNPILSGDFHVAIFSFPLSPSDSWNKLTKVNQRTFNDQPASPRFCRLLSLLQNPV,LGNTTFQRGRPFPRNGTLSCPETFMSQYSASPSRLQTVGTSLEKIREHSTTNQPPPEDSAADCYHFCRIQW

Amino Acids from 3' Exons

ASEETLHSSNEEEDPFRGMEPYLVRRLSCRNIQLPPLAFRQLEQADLKSESENIQRPTSLPLKILPLIAITSAESS,PLRKHYIPVMKRKTLSAEWNPILSGDFHVAIFSFPLSPSDSWNKLTKVNQRTFNDQPASPRFCRLLSLLQNPV,LGNTTFQRGRPFPRNGTLSCPETFMSQYSASPSRLQTVGTSLEKIREHSTTNQPPPEDSAADCYHFCRIQW