McDonnell Genome Institute

Washington University

CircRNA

chr5|55956024|55964312|-|IL6ST|ENST00000336909.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9893

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

9

Peptide

SDAAVLTIPACDFQGQHTSLLIAK

Amino Acids from 5' Exons

TLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQ,HCLLLKPMEKSWIMKLSQDGNHIYKITQLMPQNQISQMIAIQPQEILLANQMQLFLSLPVTFK,IASFSQWKNLGLSDSHKMEITFTKLHSCHKTDSKSHKSLSSNPNSKKSCWQIRCSCFNYPCLLS

Amino Acids from 3' Exons

GNTQVCLQSKTHPHLMHCLFYCVFCQHSLGRSRECPWEGYIRSYQFSCI,ATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYK,QHTSLLIAKQNVTPPPHALLIILLCILSTLKSGKQRMPLGRLHQIISILILYIK