McDonnell Genome Institute

Washington University

CircRNA

chr5|55467868|55475450|-|PPAP2A|ENST00000307259.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9748

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

AAGLPFAILTSR

Amino Acids from 5' Exons

IILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEG,LFLEKPCLFTVTFCTQIPLSGITTPLFTKPLEPFYLVQLLVSPLTLPSIQADCGLTSWMFVIQIGQKSTAAMVTLNTTYVEGMQKELRKA,YSWRNPVCLLPFALKFLYQELHSHYLQSHWNLFIWCSCSVPDHCQVFNRQTAASLLGCLSRLVKNQLQRWLHILHMSRECRKSGRQ

Amino Acids from 3' Exons

LDCLLQFLLQGIPPSNEEYSVMMSPSSTLTKKTPYLMRYVESFHSVLS,WIAFCNSYFKAYPLPTRSILVHQVPLQRRHHTLCVIRWNNHSIQYYR,GLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIV