McDonnell Genome Institute

Washington University

CircRNA

chr5|55322326|55327778|+|SKIV2L2|ENST00000230640.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

RIIYHLNHELEK

Amino Acids from 5' Exons

ETFWITIRINWKKERCRFRRYRTHFWKEAQDRRVNNRLK,KRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEESITEDL,NVLMVNYNQNQLIMEKIREMISKVQMNPFLERSPGKSQLKT

Amino Acids from 3' Exons

VALPAEEDYLPLKPRVGKAAK,LHFLQKRIIYHLNHELEKLL,CTSCRRGLFTTTTSWKSC