McDonnell Genome Institute

Washington University

CircRNA

chr5|55160329|55161255|+|GPX8|ENST00000506123.5

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9157

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

FLVAFMPLK

Amino Acids from 5' Exons

LLCLSEGCKRKNCFSGKVRQ,FYAFEVKDAKGRTVSLEKYKGK,FMPLKRMQKEELFLWKSIKA

Amino Acids from 3' Exons

VSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLV,FHLTWPVTANSQTEITGRNCTKSLDHPTSACWLFPAISLENRSPAQARKNLLQEKTTELSPSSTRLRFDLKENLHLDFLL,FTSCKRGQLPTHRQKLLRAEGTAQRVWTIPLQRVGFSLQSVWRIGAPPKQGSRIFCKKKLRSNFPHLPQDDSRIRRTCIISC