McDonnell Genome Institute

Washington University

CircRNA

chr5|5457331|5457741|+|ICE1|ENST00000296564.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

GGLFMSK

Amino Acids from 5' Exons

KNLPKQSPAPECLGKMVRYLQHRAALSGPQMCRHASQNCPWRRRTFYVKMWKNRAPVEQIVVLTMFLMRMEILRFYKVIVTVVVLNLLIMIIFLMKIFKLQLTSSNFPLLFCHQCPRPLRCHHLTRVPYRLHLH,KTCQSNHQLQSAWGRWYATSNTGQPSQDLKCADMPHKTVHGDKGGLFMSKCGKTELQWNKLFPCFEWKSGFSTKSSRWYICSSFFRSSSCNLLQTSPSSSVTSALAPSDVITSPGFLTVFICT,KPAKAITSSRVPGEDGTLPPTQGSPLRTSNVQTCLTKLSMEIKEDFLCQNVEKQSSSGTNCSSDHVFNENGNLEVLVQSHRDGGSTEFVDHDHFFDEDLQAAIDFFKLPPPLLSPVPSPPPMSSPHPGSLPSSFAP

Amino Acids from 3' Exons

KNLPKQSPAPECLGKMVRYLQHRAALSGPQMCRHASQNCPWRRRTFYVKMWKNRAPVEQIVVLTMFLMRMEILRFYKVIVTVVVLNLLIMIIFLMKIFKLQLTSSNFPLLFCHQCPRPLRCHHLTRVPYRLHLH,KTCQSNHQLQSAWGRWYATSNTGQPSQDLKCADMPHKTVHGDKGGLFMSKCGKTELQWNKLFPCFEWKSGFSTKSSRWYICSSFFRSSSCNLLQTSPSSSVTSALAPSDVITSPGFLTVFICT,KPAKAITSSRVPGEDGTLPPTQGSPLRTSNVQTCLTKLSMEIKEDFLCQNVEKQSSSGTNCSSDHVFNENGNLEVLVQSHRDGGSTEFVDHDHFFDEDLQAAIDFFKLPPPLLSPVPSPPPMSSPHPGSLPSSFAP