top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|52849364|52898383|+|ITGA1|ENST00000282588.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9242

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

KNEPLASYLVVLR

Amino Acids from 5' Exons

LFYAAAYHSMLMKIQLSAARWKTCLDILFNNMKMKKEN,CSTLLRIIQCCEKFNDFQRPGGRHVWIYCSTIKRRKM,VLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK

Amino Acids from 3' Exons

DWVMLGAVGAYDWNGTVVMQKASQIIIPRNTTFNVESTKKNEPLASYL,TGSCLEQEPMIGMEQLSCRRLVKSSLETQPLMLSLPKRMNRLLLI,LGHAWSSRSLLEWNSCHAEGSNHNPSKHNLCVYQKETACFLF

bottom of page