McDonnell Genome Institute

Washington University

CircRNA

chr5|453369|458025|+|EXOC3|ENST00000315013.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9312

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LAAESAGDR

Amino Acids from 5' Exons

CLRLGRPRTLNKGHSCKPTGSWTWSAPGTGCTSSTAWTVGTRVTPSSMATLAARRGSLMSWLSSCGWCCRGHWSLSAVTPPCWSQLSGSLKGKRKLTGAYLTGKSKLALFLLGGPRIGRRKCSPSWRGLPPELRAHRQIPESLTRCGLSATWKLGSTSWMTSLSPKTWFSAFLPTMRSLRTSTCTTKPARGCRTSHRKTWKPMRSASRGSTPTQ,ADCEGDPGPNTRGTPASPPEADGPGVLPGRADVRAVPHGQWEHAHDPHPWLLWQHAGALAGAAVDGAAEVTGHCPPPHLAGLSCQDHKGRENQAHTPEKANWLCSSWEAQELEGENVHHLGEDCDHQNGHTGRYQRVQDVACPPPGNYKEVRPGPHCRQKPDGSVLSSPLDLEPPEHVPPSPEHADAGPRIGRPGSQDREPLDVGLKHLHK,PEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYT

Amino Acids from 3' Exons

SNIIAWLRKALETDKKDWVKETEPEADQDGYYQTTLPAIVFQ,QTSSPGCGKRWRQTRKTGSKRQSQKPTRTGTTRPHSLPLSS,KHHRLAAESAGDRQERLGQRDRARSRPGRVLPDHTPCHCLP