top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|41153809|41160367|-|C6|ENST00000263413.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9519

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

TEQPQESFAR

Amino Acids from 5' Exons

GRSASSQLCRKSQLHHFRDCIELVNPLSLAPKALLLLGHQGTHARGIPGHHPFQTLSPVKK,DGVHQASCAGSPDNYTISEIVNWIHANLPQRLCCCWAIKVHMPGEFLDTTHFKLSHLK,TECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEK

Amino Acids from 3' Exons

LAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS,LPPSWTWETSPVQQNGTTSGKLCKSMQPSSILASVLHALIMADPPSQGLNVCVCVRVAPMVRTVRNSLQIINP,CPHRGLGKKHPLCSDKTEQPQESFARVCSQVRSLPVCSMPWPTHPLRDMSVCVSEWHLWELETVSRLI

bottom of page