McDonnell Genome Institute

Washington University

CircRNA

chr5|40945197|40979909|+|C7|ENST00000313164.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9767

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

12

Peptide

LVVPAHCGENVMVK

Amino Acids from 5' Exons

VKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGK,KIMILIMNFTIVLGLMNIRRQNTHHLVGSAPFLDLHHLLHAVILHIPMKSIKE,ENKFLILQYLVLCKTYVDRTHIISEALLFIFIIFFTQLYFTYQNPRK

Amino Acids from 3' Exons

TFLGCMCSREKQKDTASDSLQDACSPLSGKLHPYWGQLYSACLSESLWCLPTVGKM,PSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCD,LPWMYVLKMREAKGYCLQFARCMFSTVRVEITPLLVGTAVLCLPQLRKLVVPAHCGENVM