McDonnell Genome Institute

Washington University

CircRNA

chr5|37721114|37727045|+|WDR70|ENST00000511906.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9328

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

LGFSSIFQSVVR

Amino Acids from 5' Exons

SVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRYFISIACFRWMTTTGGRDFPPTPAFIYFPLWRSTHLENAAGTKSLKLLVLCFKKDLNIALDPHIQSESFLGICSCLAEMLSARGKNVLPTLHTTLDRGISSDTCKRFNKAGNPLTGNGISLSILLLSFLASSSLDVWQDYSLSAERDSTDTFPLHPHAHPSFKLKHTTVFQKSENVTRGSVISSVISVLLRHKDGYVSSPRKDGFVSLSSTVTDKLSLEDLVNHNSHVKFTGVPYKPVLRSHILGKESQPLLMNIHWPFCSEKQTAPSSFRASWTRVGILALYNKVYLWYLKTNRILFVFKRNKCCTDGSLFHLRKASFDSTHLEGTFCGSFALRNLLICICFSKGLCTTKEKCNVLSTFLVNPTHSWAIAPRQHCQANSVPDTCTLVFEKWTYAIWGVDHPGCFSLRHKLKFPCDLSEKVGFYYLRSNFTLFLVLTCVLLPCYLSNPLACPLTDRLAFPVAFITESPSVAIPQKVKYLCRWSACTEYVPESISCFQHEIFCFDQVKKIICFYTRGSKIMCGNPAEGKTSDSNSGLHHHPVVNMPLNHASLFYSHVVLIALRQRKPSEFRHILQNCPFMWIGLRVMQLTSVASVTHHRDRVISCSFQPKREKPVRVQYITLQFFQEQSIPSVNKKECWSWNQEAWVCPVPPLSGNVMLNNLTFNQGSVATRGRVSSSFLNSMTMCTDPQEFVYKINYLGYEKAYGRVVSLTYVTQPHSGRCVFPEPQSQTCNRQLGKKWMLQRLSLVDGPVDFISDSVWSPGGAVLLGFLTGGGSHMRPSPLELMTSKEIPHFLQEKCSQCHNSSSCNYMRPTIPPVVSEKLFSPSKYCCVVLPNVTGGYVSQLPLKAGMFYWVIWSGLSWQYRKVGGDTGRGFEVLTFYYYKFPLTFPFLPLVPREKFLLKGVSARKSQKKLLVLFWGKKRELFNTSPNNSFLFPNIILFSFLNSYNLLYSEIFHVNSNSNTHITLVFIFLFCYHIAGGIRPHVPMPRDLGTSCIHGNLYPSFSGISVPPFRLLSVVNSSEVVTFQKRVKFQCLDIGNFRADSKLLALFTFGSCKKKEAVPICVSFQNHGNVLTATHGLGDGEPHRCFHDNIQYFLSAVSCQERPVSLVSSKIGLVTVRLSFIIRSRLSLLPFHLSVSHALTMFLDGKVIVIMKFFKCDFLLMPCLCSVSPANGVQGNSWRRTDWIPSRINLNLLQAQ,VLFAACGIQSTRSWLELEMDWLKSITTPTRVRGISVLPVLDGQQLGGGISLPPPLLFISHFDGDPPIKMQLEQSKASNSWYCALKRIILPLIHTEFKAKVSWEFAVVLKCVQGGKTFCPLCIPPWTEALAVIHVRDLTKQGTNHLQEMESACPFCFFLFWLLAVWMFGKIILCPQKGTAQIRFPSTPMPTQVSNLSIPLYFKSLKTLEVQSFPQLFPFCLGTKMDMCHHPEKMVLFLSLKVQLISFLSKTWLTSIKIHMNLLGSHINLFGPTSFEERKASLYIFIGHNFALNRSRQPHLPSELPGLELESWPYTIKYIYGIKQIGFYLFFKKEIKNANVLRMGVCFTENDEPHLIAPIKALSVEALLEIYLFVFASLEKDNSVLLRRSAMFAHFWLIPHILGPPLGNTAKPTQFQTLVLLYLKSGHMPFGVTTQVALVDINNFNPVTFRVKRLGNFIIDLKISHYSYRFCKLVSCCPVTSPTLLLVNNHLTDLLFHKFKLLSLRAHLLPSLRKSSTCVDGVHAQSMFLKVSHVFNMKFSVSKTKRKFAFTPVRGAKLCVVKTQRKAKQAETLTQDYIITRKSLTCLSIMHLSSTLMWFLHSFRDRESPQNSGIYYKIAHSCGDYESCNSPLWLLLITGTGLFHAAFNPKGKSLFESNTLLYSSFFKSNSLFQVTRKSAGLGIRRPGFVQFHHVAMCTTLLIREVWRPEEGSLPAFSEILPCARLIHRNLYIKLTTWGMSRKLTRAEWFLSRMSHNLINLADVCSQSHNLKPATGDSERNNGCYSDYHWMALWTLSVTQSGAQGALYCWVFSLVVGLIDQVPWSLPVKRSHDTFCKSRSVKVSVITSLAHVITCGLLKFLQSFEVKSYFPPPKNTVVLCCPTERVAMFLSSPDSRQACFTGEYGLASVGSIGRREGILEEVLRCYRHFIDIINSLPFPSFPWSPGKSFFRGFNLHVRVKRNCYFSGAKKGSYLILPLITLSFSPRILYCFPFILIIFYILKFNFDIETVTAIERILLWFLFSYFATIQEGGPIKSPCQEIAPLAFMATFIPVSVGVFLPSGYSVLSTPPERWSHFRNVSDSSVYETSEETSGLTASCWHYSHLGPVRKNKRQSQYVFLFKTTVIKFLLPMVWEMGSLTDVSMTIFDSISVLLAARRGDQVWSQAKLANWLQDCLLLSDQDCHYDFHFIFQLVMLLCFWMGRLLLNFSNVTSCSSCLAYVPAPPTEYKETAGEGQTGSPEVATTSCSRP,CCSLPVASKAEPDHGWNWKWIGSLLRPQQESEVFHKYCLFMDDNNWGEGFPSHPRFYLFPTLMEIHPFRKCSWNKVKPQTPGIVLKGFEYCPSTLNSKRKFPGNLQLFSNVECKGEKRSAHFAYHPGQRHQYMEIQSRELTTYRKWNQLVHFASFFFGFQFGCLARLFSVRRKGQHRYVSPPPPCPPKFQTAYHCISKVKRNRFSHFLSYFRFAAQRWICVITQKRWFCFSLLKYSDAFFRVRLGLALKFTCEIYWGPITCFKVPHPLRKGKPASINEYSLAIILLIEADSPIFLQSFLDSWNPGLIQSIFMVFENKDFICFLKKKLKMLMYLGWESVSLEKMMSLIHPFRRHFLWKLCFKKFTYLYLLLLKRITLYYGEVQCSKHIFGSHTFLGHSPSATLPSQLSSRHLYSCIKVDICHLGCRPPRLLSETTKILTLPLEKGWVILLFKILKFHIIPIGFVNLCPVALLPLQPSCLLITTDQTCFSISLSFYHEPICCHPSESQVLVMECMHRVCSKYLMFSTNFLFLRPSKENNLLLHPLGEQNYVWLKPSGRQNKLRLLRTTSSPVSRHASQSCISLLLSCGFDCIALETEKALRIQAYITKLPIHVDRTTSHVTANLCGFCDSSQGQGYFMQLSTQKGKACSSPIHYFIAVFSRVTVYSKCEQERVLVLESGGLGLSSSTTEWQCDVEQLNFSGKCGDQRKGLFQLSLKFYDHVLDSTGICINLPGVVESLLGQSGFSHVCHTTSLIWQMCVPRATISNLQQVTARKEIMDATAIIISGWPCGLYQLSLEPRGRCTAGFSHWWWVSYETKSLGAYDQRDPMTLFARVEVLKSVSLVLMLHAAYLNSSSRLKKAIFPLLKILLCCVAQLSDGWLCFSAPLTQGRHVLLVSDMVWPQLAVVEGRRGYWKRFGVIDILLILIPFNLSLPSPGPPGKVSFKGGLICTESKETASTFLGQKKGVIYFPLFPFPLEYYTVFLFKFLSFIFNLILTLSKQQQLNAYYFGFYFLILLPYSRRDKAPLSPHAKRFRHLLHSWQPLSQFQWDKCSSLPVTQCCQLLLRGGHISETCEVIPVFMRHLRKLQGQQAVGIIHIWVLEKIRGSPNMCFFSKPRLSFNCYPWFGRWGASPMFPQYLTVFPECCLPGEVTSESGLKQNWLIGYSKTVFYYQIKTVIMTSISSFSSCFNYVFGWEGYCYNEIFQMLLVAHALPMFREPRQRSTRKQLEKDRLDPLKSHKPEPPVAGP

Amino Acids from 3' Exons

VVVAELEPTGALSLPILRTLLWTRPMTVILGKPFCVMPKQQKTAHIGFLQHIP,SWWPSWNPRGHSLFLYCEEHCFGQDRQSSGSHFASCQSSRRQPILGFSSIFQ,RGGRVGTHGGTLSSYIVKNIALDKTDDSNPREAILRHAKAAEDSPYWVSPAYS