McDonnell Genome Institute

Washington University

CircRNA

chr5|37302778|37310743|-|NUP155|ENST00000231498.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9665

78

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

MEELQEQLK

Amino Acids from 5' Exons

HRNFTSAATRVHCSSHSCQKFHCHFINSCRWISSIRRKNG,TEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKME,QKFHFSSDSTLLEPFLVPKVPLPFHQLPMVNFFMNKKKW

Amino Acids from 3' Exons

ELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSK,NFKSSRSPPLKILSGTKNSQGHLLLLSTATSEIMPLLMALVYIYRISAHFYIALMMQFVL,TSRAAEDHHLRSCNQGQRTHRGINCFSYQLLHQRCRCWHFTFTGYLPTSIHCNLF