McDonnell Genome Institute

Washington University

CircRNA

chr5|37121616|37157868|-|C5orf42|ENST00000509849.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9963

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LSTLPFSKR

Amino Acids from 5' Exons

IAALTLSSNLTSVRSDETVIVSTATNSTTETIAQTQPYSVFQLSTLPFSKR,LLLSEHYSRRISQAYGLMNELLSESVQLPTLPQKPLPNKPSPTQSSSCQHCPSPR,CCSLNTIVVESHKRTVMNCYLSQYSYQLYHRNHCLTNPALLSLPVVNTALLQE

Amino Acids from 3' Exons

VGHTYINVIDIEANDLLQELPVREEPSNDNVIKQQSDHLAVPSSAELHYMAASVTNAVPPHNFKSQ,LDILIMLTLKLMIFYRNYLEKSLQMIMLSNSKAIIQFHRLQSYIIWQLQLLMLFPHIILRVK,WTYLYKCDHSSSTGITCERRAFKCYQTAKRSSSSSIVCRVTLYGSFSYCCSPTFES