McDonnell Genome Institute

Washington University

CircRNA

chr5|37058890|37061018|+|NIPBL|ENST00000282516.12

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9472

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

QYLDSMVK

Amino Acids from 5' Exons

SMVKDKRKERKSSPSKENESSDSEEEVSRPRKSRKRVDSDSDSDSEDDINSVMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSD,LWRTKGKRENHHLVRKMSQATVKKKFPGLGSHGNVIQIQIQIQKTIIQNVCQKIQLLSNLQMCPRVFYYFSCNNIRIFVDFLI,YGKGQKEREKIITGKVKRQRRSFQASEVTETCRFRFRFRFRRRYKFSDEMFARKFSSFNRICKCVPGYFITSHVKTTFEESLWIF

Amino Acids from 3' Exons

NSEVLSIICKSISDKPKNRSSFSSKTNTGLPAEHGFQNHRRGEKEYSKTVSR,KIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLRSDMANSKITEEVKRSIVKQYLD,KFRSTLHLNLQKYMIKRTEKQEFIFIQNKHWTSCGVTWLIPKSQKRKGVNSI