McDonnell Genome Institute

Washington University

CircRNA

chr5|37000372|37052566|+|NIPBL|ENST00000282516.12

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.957

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

15

Peptide

RAFLISLLNLFDDTAPLGNDIK

Amino Acids from 5' Exons

PLGNDIKKMMIKLGNMKSVTEEALGIIGEVATLMKEEGVQVVVVIETEVRQILTWKIILLLPALVR,LETTKRSLGIRAQKKLWGSEKWPLSRKKEFRWWSLSKPKSVRFHGRLFSSSQP,SRKRHKKDDDKAWEYEERDRRSSGDHRRSGHSHEGRRSSGGGRYRNRSPSDSDMEDYSPPPSLSE

Amino Acids from 3' Exons

MKAVAGMKMSYQVQQAINTCLKDPVRGFRQDESSSALCSHLYSMIRGNRQHRRAFLISLLNLFDDTA,KQWLVRCLTRYNRQSTHAKILGVSDKTSPLALCVHTFTPSVETANTDEPFLFLYSTSLMTQ,ESSGWYEDVLPGTTGNQHMPKRSCKGFQTRRVLRFVFTPLLHDPWKPPTQTSLSYFFTQPLHS