McDonnell Genome Institute

Washington University

CircRNA

chr5|37000372|37000888|+|NIPBL|ENST00000282516.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9042

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

LTPEASR

Amino Acids from 5' Exons

PLGNDIKKMMIKLGNMKSVTEEALGIIGEVATLMKEEGVQVVVVIETEVRQILTWKIILLLPALVR,LETTKRSLGIRAQKKLWGSEKWPLSRKKEFRWWSLSKPKSVRFHGRLFSSSQP,SRKRHKKDDDKAWEYEERDRRSSGDHRRSGHSHEGRRSSGGGRYRNRSPSDSDMEDYSPPPSLSE

Amino Acids from 3' Exons

LLGKRKKKNRRKGKHMNQNHLK,CENEEKRKTEEKESITKTNT,ARKMKKKEKQKKRKAYEPKLTPE