McDonnell Genome Institute

Washington University

CircRNA

chr5|33989110|34005899|-|AMACR|ENST00000382085.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9935

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

RFISLTQIK

Amino Acids from 5' Exons

DLDSLMNFPIRAWMIGQKRRSLQMYLQRRRRQSGVKSLTAQMPVLRFLLRRLFIMITTRNGARLSPVRSRTAPALHLCCTPQPSLLSKGILSENTLRRYLKNLDSAAKRFISLTQIKSLKVI,TWTKVTSQSDEHGLARNEEEVCRCICREDEGRVVSNLRHRCLCDSGSDFGGCSSSQQGTGLVYHQGAGREPPPCTSAVKHPSHPFFQKGSFHRRTHGDTRIWIQPRRDLSALRNHK,LGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNK

Amino Acids from 3' Exons

VSWRNSSWAQRFCSGKIQGLFMPGVDLASQEASAGLATISTIWLCQ,CHGETPAGPRDSAAGKSKAYLCQAEWIWPVRKLLPVSWPRYQLFGFV,VMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALS