McDonnell Genome Institute

Washington University

CircRNA

chr5|32395158|32404097|-|ZFR|ENST00000265069.12

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9004

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

GALENGNETYK

Amino Acids from 5' Exons

KKVNPDLQVEVKPSIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEM,KKIQICKKSLVFEQERFKKRKGSKCRRRSTGEDEKKRSVGEWK,KSKSRFASRSKAYSSKKDSRRENEEANAEGGVLAKTRRRGALENGNE

Amino Acids from 3' Exons

TYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQK,LIKNIKDRNIKKKKLHKPHKIPAAATVLLVGLKISYVVSSAMCLVQEQMRMLPTFVVLSIR,LRTFRRTETKKRSCIESLTKYQQQQQFYSWDSKSATLALRCVLYRSRCVCCPHSWCASE