McDonnell Genome Institute

Washington University

CircRNA

chr5|31472062|31515219|-|DROSHA|ENST00000344624.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9368

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LLPTLGRR

Amino Acids from 5' Exons

MEERKCCPCTRFSCTCGAAKPWCLRRRLPICFSGRSWSGRNMQKNAKALLPTLG,WRKGSAVHAPDSPVLVKVQQSPGAGGDCQYASVGGAGVAEICRRMQRHDCYQPWD,GGKEVLSMHQILLYLLRCSKALVPEEEIANMLQWEELEWQKYAEECKGMIVTNPGT

Amino Acids from 3' Exons

SLPKGEEESSLGGRKRPLEQPEFWQRQELYLNQGKRARGDHAQEGGRRRTSACVDSMHSFRKLLLQPHGSG,RSPSREKKRARWEEEKDRWSDNQSSGKDKNYTSIKEKEPEETMPDKNEEEEEELLKPVWIRCTHSENYYSSDPMDQV,APQVGRRRELVGRKKKTVGVTTRVLAKTRTIPQSRKKSPRRPCLTRMRRKKKNFLSLCGFDALIQKTTTPVTPWIR