McDonnell Genome Institute

Washington University

CircRNA

chr5|31451532|31472232|-|DROSHA|ENST00000344624.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9744

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

SLSVADGGK

Amino Acids from 5' Exons

HAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQ,MQCYLFPIISATTNACIWTSDILSKIVVCC,CNDATCSDPSYPLPPMPNAFGQVDRIYFPRSLSVA

Amino Acids from 3' Exons

MEERKCCPCTRFSCTCGAAKPWCLRRRLPICFSGRSWSGRNMQKNAKALLPTLG,WRKGSAVHAPDSPVLVKVQQSPGAGGDCQYASVGGAGVAEICRRMQRHDCYQPWD,GGKEVLSMHQILLYLLRCSKALVPEEEIANMLQWEELEWQKYAEECKGMIVTNPGT