McDonnell Genome Institute

Washington University

CircRNA

chr5|2748344|2749787|-|IRX2|ENST00000302057.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

VPLPVPGR

Amino Acids from 5' Exons

GSACTWTRSRITRARPSRTGRSFRAAPGTPCANRARSARTSMTTWRTTRTTTRRASGAWRRPSPPRRRLPAWRRRCAPRPRPRPAVAARRPRAAGRLRARRPPPASPSCGRWPRSPRRTSSSRAWARAAGHRGCPRPPRRPQPGHRQEARPTLPRRCWAAPSTTRRPSTATTQTTGTTRRCRARVSCGTTLRPRPPARPCTPRQRRPATRARRARTRSSPTTGPRAAATSPRK,DQPARGLAHGSLVLGRVGRGEASVPRRGPPVRIGLGVQGQVRPGGRRGRRRGGRAGPGAAQARDLVAAYRLGGAAAEPPARGRAPRWPQDAPGQPDVSGRAAPRQQAQAVVAGRDRHVGPQAAEPGPGLRATGAARGRRAGLNRGTARRLALPCLAAAGPPPLLHVALLRQLHKLRELERGAAGPGSPAVQLCGRGPRRGPAHRAKGGQRRGQGGRAPARVPLPVPGRRLRAQE,ISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEALHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKK

Amino Acids from 3' Exons

GAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDE,AHPTTRTPPAPAPSATTRTAARPTRTSSTTPRTARTPRGTPRPLSRPGSTSTARTPTPPRARRSCPSSPRPSPRSPPGSPTRAGASRRRTRPGPRETKAKMRTRTRATLPEARTRVPTRRRRARRPRQRTK,RTLRRAHHRHDRRHQLPPVRQRGLPVPAQRPRVPQERHAGRHGHSQGLAQRAPQEPLPHQGREDHASHHHQDDPHPGLHLVRQRAPAPQEGEQDDLGPEKQKRRGRGRGRRYQKQGRESRQGAGGHGDLGRGR